LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
Human FGF18 Protein (Recombinant) - LS-G3621
Catalog
Size
Price
LS-G3621-5
5 µg
$225
LS-G3621-25
25 µg
$295
Description
Human FGF18 Protein (Recombinant) - LS-G3621
Type
Animal-Free  Recombinant Protein
Target
FGF18
Species
Human
AA Sequence
AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is <=0.5 ng/ml, corresponding to a specific activity of >=2 x 10^6 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About FGF18
O76093 NM_003862 NP_003853.1

Popular FGF18 Proteins

Protein
Source: E. coli Expression System
AA Sequence Size: 172 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
AA Sequence Size: 173 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.
Protein
Source: E. coli Expression System
AA Sequence Size: 180 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/18/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy