Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5497-100 100 µg $475 
FBP1 Protein

Human FBP1 Protein (Recombinant His) - LS-G5497

Human FBP1 Protein (Recombinant His) - LS-G5497

Description:
FBP1 Protein LS-G5497 is a Recombinant Human FBP1 produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$475
LS-G5497-100
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
FBP1 Protein LS-G5497 is a Recombinant Human FBP1 produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
FBP1
Synonyms
FBP1 | Fructose-bisphosphatase 1 | FBP | Fructose 1,6-bisphosphatase | Fructose-1,6-bisphosphatase 1 | Growth-inhibiting protein 17 | FBPase 1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
39.0 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity is > 0.30 unit/ml, in which one unit will convert 1.0 µmole of fructose 1, 6-diphosphate to fructose 6-phosphate and inorganic phosphate per minute at pH 9.5 at 25°C.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 1 mM DTT, 10% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FBP1
P09467 NM_000507 NP_000498.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FBP1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021