Products

Antibodies
All Antibodies
Primary Antibodies
Secondary Antibodies
IHC-plus Antibodies
Isotype Control Antibodies

ELISA and Assay Kits
All Kits
Assay Kits
Traditional ELISA Kits
Cell-Based ELISA Kits
DNA-Binding ELISA Kits
Phospho-Specific ELISA Kits
ELISA Development Kits
Chemiluminescent CLIA Kits

Proteins
All Proteins
Recombinant Proteins
Native Proteins
Over-expression Lysates
Cell and Tissue Lysates
Bio-active Proteins
Animal-free Proteins
Synthetic Peptides

Biochemicals
All Biochemicals

Immunohistochemistry
Immunohistochemistry Reagents
Comprehensive IHC Reports
Custom IHC Services
TCR Screening Services
IHC-plus Antibodies

Services

Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Have a question? CustomerSupport@LSBio.com

Research Areas

Cancer Research:
Breast Cancer IHC
Colorectal Cancer IHC
Lung Cancer IHC
Prostate Cancer IHC

Cell Cycle:
Apoptosis

Protein Family and Group:
Caspases
Chemokines

Resources

Purchasing
Product Ordering Terms and Conditions
Holiday Schedule
About the LSBio Guarantee
About Reviews

Reference Material
About LSBio (LifeSpan BioSciences Inc.)
About Our 2-million Specimen Tissue Bank
About Our IHC Validation Process
About Our IHC-plus™ Immunohistochemistry Protocol
Protocols

Secure Logins
Login to Our Secure ShareFile Site
Login to Our IHC Database

Distributors

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone:	866-819-4732 (Toll Free North America) 206-374-1102 (International)

Fax:	866-206-6909 (Toll Free North America) 206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Forgot password?

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Login Name*:
Email*:
Password*:
Confirm Password*:
Name:
Organization:
Role:

Fields marked with a * are required.

Wish List

View Cart

Human EMC8 / COX4NB Protein (Recombinant GST) (Full Length) - LS-G32092

Catalog	Size	Price
LS-G32092-10	10 µg	Unavailable
LS-G32092-25	25 µg	Unavailable

LSBio (USA Sales Only)

Phone:	206-374-1102
Fax:	866-206-6909
Email:	Orders@LSBio.com

Related Products

18 EMC8 / COX4NB Antibodies
9 EMC8 / COX4NB Proteins

Most Popular EMC8 / COX4NB Proteins

Human EMC8 / COX4NB Protein (Recombinant His) - LS-G1410

Source:	E. coli Expression System
AA Sequence Size:	230 AA
Tag:	His
Format:	Purified

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Human EMC8 / COX4NB Protein (Recombinant His) - LS-G20314

Source:	E. coli Expression System
Tag:	His
Format:	Purified

Human EMC8 / COX4NB Protein (Recombinant GST) (Full Length) - LS-G32091

Source:	Wheat Wheat Germ Extract
AA Sequence Size:	210 AA
Tag:	GST
Format:	Purified

12.5% SDS-PAGE of human COX4NB stained with Coomassie Blue

Human EMC8 / COX4NB Protein (Recombinant GST) (Full Length) - LS-G32092

Source:	Wheat Wheat Germ Extract
AA Sequence Size:	210 AA
Tag:	GST
Format:	Purified

E. coli EMC8 / COX4NB Protein (Met1-Cys210) - LS-G50650

Tag:	None
Format:	Purified / Lyophilized

Catalog Number:	LS-G32092
Type:	Recombinant Protein
Target:	EMC8 / COX4NB
Species:	Human
Predicted Molecular Weight:	50.2 kDa Full Length
AA Sequence:	MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Expression System:	Wheat Germ Extract
Source Species:	Wheat
Tag:	GST
Purification:	Glutathione Sepharose
Bio-Activity:	Not Tested
Endotoxin:	Not Tested
Presentation:	50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage:	Store at -80°C. Avoid freeze-thaw cycles.
Restrictions:	For research use only.

About EMC8 / COX4NB

Uniprot: O43402 NCBI: NM_006067 NP_006058.1

Synonyms: EMC8 Protein, C16orf2 Protein, C16orf4 Protein, COX4AL Protein, COX4NB Protein, FAM158B Protein, NOC4 Protein, Protein FAM158B Protein, COX4 neighbor Protein, Neighbor of COX4 Protein

(More About EMC8 / COX4NB)

Print This Page Email

Technical Help Review

Review This Product

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

12.5% SDS-PAGE of human COX4NB stained with Coomassie Blue

Requested From:
Date Requested: 6/23/2018

Get Social With Us!

Catalog Number