Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G2865-100 100 µg (0.5 mg/ml) $315 
LS-G2865-0.5 0.5 mg (0.5 mg/ml) $695 
COPS7A Protein

Human COPS7A Protein (Recombinant His) - LS-G2865

Human COPS7A Protein (Recombinant His) - LS-G2865

Description:
COPS7A Protein LS-G2865 is Recombinant Human COPS7A in E. coli with His tag(s).
Price
Catalog Number
$315 
LS-G2865-100
Toll Free North America
866-819-4732

Overview

Description:
COPS7A Protein LS-G2865 is Recombinant Human COPS7A in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
COPS7A
Species
Human
Modifications
Unmodified
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 80% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.4 M Urea, 10% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About COPS7A
Q9UBW8 NM_016319 NP_057403.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

COPS7A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

COPS7A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

COPS7A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

COPS7A Protein

Requested From: United States
Date Requested: 12/6/2019