Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21880-10 10 µg $282 
LS-G21880-100 100 µg $400 
LS-G21880-1 1 mg $1,152 
CLEC4C / CD303 / BDCA-2 Protein

Human CLEC4C / CD303 / BDCA-2 Protein (Recombinant 6His-SUMO, N-terminus) (aa45-213) - LS-G21880

Human CLEC4C / CD303 / BDCA-2 Protein (Recombinant 6His-SUMO, N-terminus) (aa45-213) - LS-G21880

Description:
CLEC4C / CD303 / BDCA-2 Protein LS-G21880 is a Recombinant Human CLEC4C / CD303 / BDCA-2 produced in E. coli aa 45-213 with 6His-SUMO, N-terminus tag(s). It is biologically active.
Price
Catalog Number
$282
LS-G21880-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
CLEC4C / CD303 / BDCA-2 Protein LS-G21880 is a Recombinant Human CLEC4C / CD303 / BDCA-2 produced in E. coli aa 45-213 with 6His-SUMO, N-terminus tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
CLEC4C / CD303 / BDCA-2
Synonyms
CLEC4C | BDCA-2 | Blood dendritic cell antigen 2 | CD303 | CD303 antigen | CLECSF11 | CLECSF7 | Dendritic cell lectin b | Dendritic lectin | HECL | PRO34150 | BDCA2 | DLEC
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
aa 45-213
Predicted Molecular Weight
35.94 kD
AA Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 µg/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 µg/ml.
Endotoxin
Not Tested
Presentation
Lyophilized from 10 mM Tris-HCL, 1mM EDTA, 6% Trehalose, pH 8.0
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: store at 4°C for up to 1 week. Long term: store at -20°C regardless of reconstitution; aliquot to avoid freeze-thaw cycles after reconstitution.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CLEC4C / CD303 / BDCA-2
Q8WTT0 NP_569708.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CLEC4C / CD303 / BDCA-2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CLEC4C / CD303 / BDCA-2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CLEC4C / CD303 / BDCA-2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CLEC4C / CD303 / BDCA-2 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021