Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5101-100 100 µg $466 
CD74 / CLIP Protein

Human CD74 / CLIP Protein (Recombinant His) - LS-G5101

Human CD74 / CLIP Protein (Recombinant His) - LS-G5101

Available for shipment within the USA only
Description:
CD74 / CLIP Protein LS-G5101 is a Recombinant Human CD74 / CLIP produced in E. coli with His tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein.
Price
Catalog Number
$466
LS-G5101-100

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
CD74 / CLIP Protein LS-G5101 is a Recombinant Human CD74 / CLIP produced in E. coli with His tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein.

Specifications

Type
Recombinant Protein
Target
CD74 / CLIP
Synonyms
CD74 | CD74 antigen | DHLAG | HLADG | HLA-DR-gamma | Ia-associated invariant chain | p33 | MHC HLA-DR gamma chain | Ia-GAMMA
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
20.6 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein.
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 30% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD74 / CLIP
P04233 NM_004355 NP_004346.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD74 / CLIP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD74 / CLIP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD74 / CLIP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CD74 / CLIP Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2021