Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G1803-50 50 µg (0.25 mg/ml) $401 
LS-G1803-250 250 µg (0.25 mg/ml) $925 
CCNB2 / Cyclin B2 Protein

Human CCNB2 / Cyclin B2 Protein (Recombinant His) - LS-G1803

Human CCNB2 / Cyclin B2 Protein (Recombinant His) - LS-G1803

Description:
CCNB2 / Cyclin B2 Protein LS-G1803 is a Recombinant Human CCNB2 / Cyclin B2 produced in E. coli with His tag(s).
Price
Catalog Number
$401
LS-G1803-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
CCNB2 / Cyclin B2 Protein LS-G1803 is a Recombinant Human CCNB2 / Cyclin B2 produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
CCNB2 / Cyclin B2
Synonyms
CCNB2 | Cyclin B2 | G2/mitotic-specific cyclin-B2 | HsT17299
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.2 M NaCl, 5 mM DTT, 50% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCNB2 / Cyclin B2
O95067 NM_004701 NP_004692.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCNB2 / Cyclin B2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCNB2 / Cyclin B2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCNB2 / Cyclin B2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCNB2 / Cyclin B2 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/17/2021