Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G30347-2 2 µg $429 
CCL19 / MIP3-Beta Protein - 12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue

Human CCL19 / MIP3-Beta Protein (Recombinant GST) (Full Length) - LS-G30347

Human CCL19 / MIP3-Beta Protein (Recombinant GST) (Full Length) - LS-G30347

Available for shipment within the USA only
Description:
CCL19 / MIP3-Beta Protein LS-G30347 is a Recombinant Human CCL19 / MIP3-Beta produced in Wheat Germ Extract with GST tag(s).
Price
Catalog Number
$429
LS-G30347-2

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CCL19 / MIP3-Beta Protein LS-G30347 is a Recombinant Human CCL19 / MIP3-Beta produced in Wheat Germ Extract with GST tag(s).

Specifications

Type
Recombinant Protein
Target
CCL19 / MIP3-Beta
Synonyms
CCL19 | C-C motif chemokine 19 | CKb11 | CC chemokine ligand 19 | EBI1 ligand chemokine | EBI1-ligand chemokine | Exodus-3 | ELC | MIP-3-beta | MIP3B | SCYA19 | Small-inducible cytokine A19 | Beta chemokine exodus-3 | Beta-chemokine exodus-3 | CK beta-11 | MIP-3b
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Predicted Molecular Weight
36.52 kDa
AA Sequence
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCL19 / MIP3-Beta
Q99731 NM_006274 NP_006265.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCL19 / MIP3-Beta Protein - 12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue
12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCL19 / MIP3-Beta Protein - 12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue
12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCL19 / MIP3-Beta Protein - 12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue
12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CCL19 / MIP3-Beta Protein - 12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue
12.5% SDS-PAGE of human CCL19 stained with Coomassie Blue

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/27/2022