Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G2353-20 20 µg (0.25 mg/ml) $315 
LS-G2353-100 100 µg (0.25 mg/ml) $695 
BUD31 Protein

Human BUD31 Protein (Recombinant His) - LS-G2353

Human BUD31 Protein (Recombinant His) - LS-G2353

Description:
BUD31 Protein LS-G2353 is a Recombinant Human BUD31 produced in E. coli with His tag(s).
Price
Catalog Number
$315
LS-G2353-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
BUD31 Protein LS-G2353 is a Recombinant Human BUD31 produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
BUD31
Synonyms
BUD31 | BUD31 homolog (S. cerevisiae) | BUD31 homolog (yeast) | EDG-2 | EDG2 | FSAP17 | G10 | G10 protein homolog | Protein G10 homolog | Protein BUD31 homolog | Protein EDG-2 | Maternal G10 transcript | YCR063W | Cwc14
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.2 M NaCl, 40% glycerol, 2 mM DTT
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About BUD31
P41223 NM_003910 NP_003901.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BUD31 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BUD31 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BUD31 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BUD31 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/7/2021