Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5528-100 100 µg $462 
BLVRA Protein

Human BLVRA Protein (Recombinant) - LS-G5528

Human BLVRA Protein (Recombinant) - LS-G5528

Description:
BLVRA Protein LS-G5528 is a Recombinant Human BLVRA produced in E. coli. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$462
LS-G5528-100
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
BLVRA Protein LS-G5528 is a Recombinant Human BLVRA produced in E. coli. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
BLVRA
Synonyms
BLVRA | Biliverdin reductase A | BVR A | BLVR | BVRA | BVR | Biliverdin-IX alpha-reductase
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
33.3 kDa
AA Sequence
MAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity is > 30 pmoles/min/µg. One unit BLVRA will transform 1.0 pmole of biliverdin to bilirubin per minute in an NADPH dependent reaction pH 8.0 at 25°C.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
20 mM Tris-HCl, pH 8.0, 10% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About BLVRA
P53004 NM_000712 NP_000703.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BLVRA Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BLVRA Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BLVRA Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BLVRA Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021