LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human BDNF Protein (Recombinant) - LS-G55823

Catalog
Size
Price
LS-G55823-2
2 µg
$205
LS-G55823-10
10 µg
$285
LS-G55823-100
100 µg
$725
LS-G55823-500
500 µg
$3,555
LS-G55823-1
1 mg
$5,940
Description
BDNF Protein LS-G55823 is Recombinant Human BDNF in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Animal-Free  Recombinant Protein
Target
BDNF
Species
Human
Predicted Molecular Weight
27.2 kDa
Details
Brain-derived neurotrophic factor (BDNF) is a nerve growth factor that binds two receptors, the low-affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase B (TrkB), to support neuron growth and survival. BDNF expression in the hippocampus is essential for long-term memory storage and learning. Human, mouse, rat, and pig BDNF are cross-reactive. This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
AA Sequence
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Tested using: C6 cell proliferation. Less than or equal to 2 ug/mL and greater than or equal to 5.0 x 10^2 units/mg. Typical ED50 is less than 1 ug/mL.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
About BDNF
P23560 NM_001709 NP_001700.2

Popular BDNF Proteins

Recombinant Brain Derived Neurotrophic Factor By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Recombinant Brain Derived Neurotrophic Factor By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Recombinant Brain Derived Neurotrophic Factor By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: His
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis


Requested From: United States
Date Requested: 2/18/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy