Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5525-100 100 µg $484 
ARTS Protein

Human ARTS Protein (Recombinant His) - LS-G5525

Human ARTS Protein (Recombinant His) - LS-G5525

Description:
ARTS Protein LS-G5525 is a Recombinant Human ARTS produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$484
LS-G5525-100
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
ARTS Protein LS-G5525 is a Recombinant Human ARTS produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
ARTS
Synonyms
PRPS1 | ARTS | CMTX5 | DFN2 | DFNX1 | PPRibP | PRS-I | PRSI
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
36.9 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity: > 1 Units/ml. One unit will catalyze the formation of 1.0 µmole of AMP from ATP and ribose-5-phosphate per minute at pH 7.6 at 37°C.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 20% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARTS
P60891 NM_002764 NP_002755.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARTS Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARTS Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARTS Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARTS Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021