Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > AK3 / Adenylate Kinase 3 > LS-G136538
 
Print Page  
Catalog Number Size Price
LS-G136538-20 20 µg $364 
LS-G136538-100 100 µg $500 
LS-G136538-1 1 mg $1,679 
AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Human AK3 / Adenylate Kinase 3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136538

Human AK3 / Adenylate Kinase 3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136538

Submit Review LSBio Guarantee
Description:
AK3 / Adenylate Kinase 3 Protein LS-G136538 is a Recombinant Human AK3 / Adenylate Kinase 3 produced in E. coli 1-227aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136538-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Request SDS/MSDS

Overview

Description:
AK3 / Adenylate Kinase 3 Protein LS-G136538 is a Recombinant Human AK3 / Adenylate Kinase 3 produced in E. coli 1-227aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
AK3 / Adenylate Kinase 3
Synonyms
AK3 | AK 3 | AKL3L1 | Adenylate kinase 3 alpha like | Adenylate kinase 3 like 1 | Adenylate kinase 3 | Adenylate kinase 6 | AK3L1 | AK6 | AKL3L | FIX
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-227aa
Predicted Molecular Weight
32.6 kDa
AA Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About AK3 / Adenylate Kinase 3
Q9UIJ7 NM_016282 NP_057366.2

Publications (0)

Submit a Publication for LS-G136538

Customer Reviews (0)

Submit a review for LS-G136538

Images

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Mass Cytometry

AK3 / Adenylate Kinase 3 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AK3 / Adenylate Kinase 3 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/23/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com