Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G127401-100 100 µg $375 
Protein

FGL1 / Hepassocin Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G127401

FGL1 / Hepassocin Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G127401

Available for shipment within the USA only
Description:
FGL1 / Hepassocin Protein LS-G127401 is Over-Expression Lysate FGL1 / Hepassocin in Human with Myc + DDK tag(s).
Price
Catalog Number
$375 
LS-G127401-100
100 µg

Available for shipment within the USA only
Toll Free North America
866-819-4732

Overview

Description:
FGL1 / Hepassocin Protein LS-G127401 is Over-Expression Lysate FGL1 / Hepassocin in Human with Myc + DDK tag(s).

Specifications

Type
Over-Expression Lysate Protein
Target
FGL1 / Hepassocin
Synonyms
FGL1 | Fibrinogen-like 1 | Hepassocin | HFREP-1 | HFREP1 | HP-041 | LFIRE-1 | Fibrinogen-like protein 1 | LFIRE1
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
34 kDa
AA Sequence
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
Unpurified
Usage Summary
Intended for use as a Western blot control. Spin down briefly and dilute with 2xSDS Sample Buffer provided (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Storage
Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.
Restrictions
For research use only. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGL1 / Hepassocin
Q08830 NM_004467 NP_004458.3

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 2/28/2020