Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22423-20 20 µg $395 
LS-G22423-100 100 µg $565 
LS-G22423-1 1 mg $1,646 
Protein

E. coli rpsJ / Ribosomal Protein S10 (Recombinant GST) (Full Length) - LS-G22423

E. coli rpsJ / Ribosomal Protein S10 (Recombinant GST) (Full Length) - LS-G22423

Description:
rpsJ / Ribosomal Protein S10 Protein LS-G22423 is a Recombinant E. coli rpsJ / Ribosomal Protein S10 produced in E. coli aa 1-103 with GST tag(s).
Price
Catalog Number
$395
LS-G22423-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
rpsJ / Ribosomal Protein S10 Protein LS-G22423 is a Recombinant E. coli rpsJ / Ribosomal Protein S10 produced in E. coli aa 1-103 with GST tag(s).

Specifications

Type
Recombinant Protein
Target
rpsJ / Ribosomal Protein S10
Synonyms
rpsJ
Species
E. coli
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Region
aa 1-103
Predicted Molecular Weight
39.1 kD
AA Sequence
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About rpsJ / Ribosomal Protein S10
NP_417780.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/21/2021