Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22910-20 20 µg $385 
LS-G22910-100 100 µg $548 
LS-G22910-500 500 µg $1,279 
EPO / Erythropoietin Protein

Cynomolgus monkey EPO / Erythropoietin Protein (Recombinant His) (aa28-192) - LS-G22910

Cynomolgus monkey EPO / Erythropoietin Protein (Recombinant His) (aa28-192) - LS-G22910

Description:
EPO / Erythropoietin Protein LS-G22910 is a Recombinant Cynomolgus monkey EPO / Erythropoietin produced in Yeast aa 28-192 with His tag(s).
Price
Catalog Number
$385
LS-G22910-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
EPO / Erythropoietin Protein LS-G22910 is a Recombinant Cynomolgus monkey EPO / Erythropoietin produced in Yeast aa 28-192 with His tag(s).

Specifications

Type
Recombinant Protein
Target
EPO / Erythropoietin
Synonyms
EPO | EP | MVCD2 | Erythropoietin
Species
Cynomolgus monkey
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 28-192
Predicted Molecular Weight
20.23 kD
AA Sequence
APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Expression System
Yeast
Source Species
Yeast
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About EPO / Erythropoietin
P01588 NM_000799 NP_000790.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EPO / Erythropoietin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EPO / Erythropoietin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EPO / Erythropoietin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EPO / Erythropoietin Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021