Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23102-10 10 µg $325 
LS-G23102-50 50 µg $395 
LS-G23102-100 100 µg $620 
LS-G23102-200 200 µg $1,005 
LS-G23102-500 500 µg $1,425 
LS-G23102-1 1 mg $2,205 
RBP3 / IRBP Protein

Bovine RBP3 / IRBP Protein (Recombinant His) (aa633-1231) - LS-G23102

Bovine RBP3 / IRBP Protein (Recombinant His) (aa633-1231) - LS-G23102

Description:
RBP3 / IRBP Protein LS-G23102 is Recombinant Bovine RBP3 / IRBP aa 633-1231 produced in Yeast with His tag(s).
Price
Catalog Number
$325 
LS-G23102-10
Toll Free North America
866-819-4732

Overview

Description:
RBP3 / IRBP Protein LS-G23102 is Recombinant Bovine RBP3 / IRBP aa 633-1231 produced in Yeast with His tag(s).

Specifications

Type
Recombinant Protein
Target
RBP3 / IRBP
Species
Bovine
Modifications
Unmodified
Predicted Molecular Weight
34.4 kD
AA Sequence
AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About RBP3 / IRBP
P10745 NM_002900 NP_002891.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RBP3 / IRBP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RBP3 / IRBP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RBP3 / IRBP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RBP3 / IRBP Protein

Requested From: United States
Date Requested: 12/13/2019