Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23207-20 20 µg $419 
LS-G23207-100 100 µg $637 
LS-G23207-1 1 mg $1,974 
Factor Xa Inhibitor BuXI Protein

Bauhinia ungulata Factor Xa Inhibitor BuXI Protein (Recombinant His) (Full Length) - LS-G23207

Bauhinia ungulata Factor Xa Inhibitor BuXI Protein (Recombinant His) (Full Length) - LS-G23207

Description:
Factor Xa Inhibitor BuXI Protein LS-G23207 is a Recombinant Bauhinia ungulata Factor Xa Inhibitor BuXI produced in Yeast aa 1-172 with His tag(s).
Price
Catalog Number
$419
LS-G23207-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
Factor Xa Inhibitor BuXI Protein LS-G23207 is a Recombinant Bauhinia ungulata Factor Xa Inhibitor BuXI produced in Yeast aa 1-172 with His tag(s).

Specifications

Type
Recombinant Protein
Target
Factor Xa Inhibitor BuXI
Synonyms
BuXI
Species
Bauhinia ungulata
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 1-172
Predicted Molecular Weight
21.2 kD
AA Sequence
DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Factor Xa Inhibitor BuXI
P83594

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Factor Xa Inhibitor BuXI Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Factor Xa Inhibitor BuXI Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Factor Xa Inhibitor BuXI Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Factor Xa Inhibitor BuXI Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/21/2021