Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13370-50 50 µl (1.01 mg/ml) $440 
VIP Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
VIP Antibody - Western blot analysis of extracts of various cell lines, using VIP antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
VIP Antibody - Western blot analysis of extracts of Jurkat cell lines, using VIP antibody.
VIP Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
VIP Antibody - Western blot analysis of extracts of various cell lines, using VIP antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
VIP Antibody - Western blot analysis of extracts of Jurkat cell lines, using VIP antibody.
1 of 3
2 of 3
3 of 3

PathPlus™ Polyclonal Rabbit anti‑Human VIP Antibody (IHC, WB) LS‑B13370

PathPlus™ Polyclonal Rabbit anti‑Human VIP Antibody (IHC, WB) LS‑B13370

Note: This antibody replaces LS-C331701
Antibody:
VIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$440
LS-B13370-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
VIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
VIP belongs to the glucagon family and serves to stimulates myocardial contractility. It causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. References: The UniProt Consortium. Nucleic Acids Res. 47: D506-515 (2019); Nucleic Acids Res. 2016 Jan 4;44(D1):D733-45, PMID:26553804
Target
Human VIP
Synonyms
VIP | PHM27 | Vasoactive intestinal peptide | VIP peptides
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1). APSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Specificity
Human VIP
Applications
  • IHC (1:50 - 1:100)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 19kDa, while the observed MW by Western blot was 14kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About VIP
P01282 NM_003381 NP_003372.1

Validation

VIP Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

PathPlus™ VIP Antibody for IHC, WB/Western LS-B13370 has an LSBio Rating of
Laboratory Validation Score (5)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/4/2021