LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Pig GLP2 ELISA Kit (Competitive EIA) - LS-F9872


Size Price
1 plate $940
Discounts 5+ units 10%
Inquire for larger quantities
LSBio (Direct) LSBio (Direct)

Most Popular GLP2 Elisa Kits

Mouse GLP2 ELISA Kit (Competitive EIA) - LS-F25094
Competitive EIA
96-Well Strip Plate
24.69-2000 pg/ml
Colorimetric - 450nm
Serum, Plasma
Human GLP2 ELISA Kit (Competitive EIA) - LS-F6546
Competitive EIA
96-Well Strip Plate
123.46-10000 pg/ml
Colorimetric - 450nm
Cell Culture Supernatants, Cell Lysates, Serum, Tissue Homogenates, Plasma
Pig GLP2 ELISA Kit (Competitive EIA) - LS-F9872
Competitive EIA
96-Well Strip Plate
123.46-10000 pg/ml
Colorimetric - 450nm
Cell Culture Supernatants, Cell Lysates, Serum, Tissue Homogenates, Plasma

100% Guaranteed 100% Guaranteed
Competitive EIA (enzyme immunoassay) kit
Glucagon Like Peptide 2 (GLP2) No significant cross-reactivity or interference between Glucagon Like Peptide 2 (GLP2) and analogs was observed.
LS-F9872 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Pig GLP2 in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of GLP2 as low as 47.2 picograms per milliliter.
All LSBio Custom kits have been predesigned and all necessary components, including antibodies and standards have been identified. Upon receiving a custom kit order, the kit will be assembled and quality control tested before being shipped out. Kit assembly and testing typically takes 4 to 6 weeks. In most cases the final kit is based on the Sandwich assay principle, with a few being Competitive EIA based. Specifications such as Range, Sensitivity, and Precision are defined upon completion. In the event that the custom kit cannot be successfully developed with 6 weeks of the order date, the customer will be notified and the order canceled at no cost.
Cell Culture Supernatants, Cell Lysates, Plasma, Serum, Tissue Homogenates
96-Well Strip Plate
Colorimetric - 450nm (TMB)
123.46 - 10000 pg/ml
47.2 pg/ml
2.5 h
Intra-Assay: CV<10% Inter-Assay: CV<12%
Due to their limited shelf life, LSBio ELISA kits are not typically stocked as finished goods. Upon receipt of an order each kit is assembled and tested to ensure that it meets specifications before shipping. Minor changes may occur to the Range, Sensitivity, and Precision. In the event of a significant change the order would be confirmed with the customer before shipping. ELISA kit lot numbers reflect the date of final assembly and testing for each specific kit rather than a bulk manufactured lot. All kits are tested to confirm that they fall within their defined Inter- and Intra- assay coefficient of variation.
  • Coated 96-well Strip Plate
  • Adhesive Plate Sealers
  • Standard (Lyophilized)
  • Sample Diluent
  • Detection Reagent A (Green)
  • Detection Reagent B (Red)
  • Assay Diluent A
  • Assay Diluent B
  • TMB Substrate
  • Stop Solution
  • Wash Buffer (30x concentrate)
For research use only.

About GLP2

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

Requested From: United States
Date Requested: 1/20/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number