Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
Chicken GLP2 ELISA Kit (Competitive EIA) - LS-F37799
LS-F37799 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Chicken GLP2 in samples of Plasma and Serum. It is based upon a Competitive EIA assay principle and can be used to detect levels of GLP2 as low as 0.094 nanograms per millilter.
1 plate
Available Discounts
5% off 5+ units

Popular GLP2 Elisa Kits

Type: Competitive EIA
Format: 96-Well Strip Plate
Reactivity: Human
Range: 123.46-10000 pg/ml
Detection: Colorimetric - 450nm (TMB)
Sample Types: Cell Culture Supernatants, Cell Lysates, Serum, Tissue Homogenates, Plasma
Type: Competitive EIA
Format: 96-Well Strip Plate
Reactivity: Pig
Range: 123.46-10000 pg/ml
Detection: Colorimetric - 450nm (TMB)
Sample Types: Cell Culture Supernatants, Cell Lysates, Serum, Tissue Homogenates, Plasma
Type: Competitive EIA
Format: 96-Well Strip Plate
Reactivity: Mouse
Range: 24.69-2000 pg/ml
Detection: Colorimetric - 450nm (TMB)
Sample Types: Serum, Plasma
Type: Quantitative Competitive EIA
Format: 96-Well Strip Plate
Reactivity: Human
Range: 0.156-10 ng/ml
Detection: Colorimetric - 450nm (TMB)
Sample Types: Serum, Plasma

Product Description

LS-F37799 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Chicken GLP2 in samples of Plasma and Serum. It is based upon a Competitive EIA assay principle and can be used to detect levels of GLP2 as low as 0.094 nanograms per millilter.
About GLP2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.


Competitive EIA (enzyme immunoassay) kit
Intended Sample Types
Plasma, Serum
96-Well Strip Plate
Colorimetric - 450nm (TMB)
Detection Range
0.156 - 10 ng/ml
Assay Time
4.5 h
Intra-Assay: CV<10% Inter-Assay: CV<10%
Short term: 4°C; Long term: see manual.
Quality Assurance
Due to their limited shelf life, LSBio ELISA kits are not typically stocked as finished goods. Upon receipt of an order each kit is assembled and tested to ensure that it meets specifications before shipping. Minor changes may occur to the Range, Sensitivity, and Precision. In the event of a significant change the order would be confirmed with the customer before shipping ELISA kit lot numbers reflect the date of final assembly and testing for each specific kit rather than a bulk manufactured lot. All kits are tested to confirm that they fall within their defined Inter- and Intra- assay coefficient of variation.
Kit Components
  • Coated 96-well Strip Plate
  • Adhesive Plate Sealers
  • Sample Diluent
  • Wash Buffer (25x)
  • TMB Substrate
  • Stop Solution
  • Standard (Lyophilized)
  • HRP-Streptavidin Conjugate Diluent
  • Biotinylated Detection Antibody Diluent
  • HRP-Streptavidin Conjugate (100x)
  • Biotinylated Detection Antibody (100x)
For research use only.
This elisa kit carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)


Competition ELISA Platform Overview
Competition ELISA Platform Overview

Competition ELISA Platform Overview
Competition ELISA Platform Overview

Competition ELISA Platform Overview
Competition ELISA Platform Overview

Competition ELISA Platform Overview
Competition ELISA Platform Overview

Requested From: United States
Date Requested: 8/16/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number