Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334351-20 20 µl $263 
LS-C334351-50 50 µl $301 
LS-C334351-100 100 µl $359 
LS-C334351-200 200 µl $473 
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human prostate cancer tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human stomach tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human mammary cancer tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human adenomyosis.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human gastric tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human gastric cancer tissue.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of HeLa cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of HeLa cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of A549 cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of U2OS cells.
XRCC5 / Ku80 Antibody - Western blot analysis of extracts of various cell lines.
XRCC5 / Ku80 Antibody - Immunoprecipitation analysis of 200ug extracts of 293T cells.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human prostate cancer tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded human stomach tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human mammary cancer tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human adenomyosis.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human gastric tissue.
XRCC5 / Ku80 Antibody - Immunohistochemistry of paraffin-embedded Human gastric cancer tissue.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of HeLa cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of HeLa cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of A549 cells.
XRCC5 / Ku80 Antibody - Immunofluorescence analysis of U2OS cells.
XRCC5 / Ku80 Antibody - Western blot analysis of extracts of various cell lines.
XRCC5 / Ku80 Antibody - Immunoprecipitation analysis of 200ug extracts of 293T cells.
1 of 13
2 of 13
3 of 13
4 of 13
5 of 13
6 of 13
7 of 13
8 of 13
9 of 13
10 of 13
11 of 13
12 of 13
13 of 13

Polyclonal Rabbit anti‑Human XRCC5 / Ku80 Antibody (IHC, IF, WB) LS‑C334351

Polyclonal Rabbit anti‑Human XRCC5 / Ku80 Antibody (IHC, IF, WB) LS‑C334351

Antibody:
XRCC5 / Ku80 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334351-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
XRCC5 / Ku80 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Ku80 antibody LS-C334351 is an unconjugated rabbit polyclonal antibody to human Ku80 (XRCC5). Validated for IF, IHC, IP and WB.
Target
Human XRCC5 / Ku80
Synonyms
XRCC5 | 86 kDa subunit of Ku antigen | CTC85 | CTCBF | DNA repair protein XRCC5 | G22P2 | KARP-1 | Ku autoantigen, 80kDa | NFIV | KARP1 | Ku86 | KUB2 | TLAA | Nuclear factor IV | KU80 | Thyroid-lupus autoantigen
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of human XRCC5 (NP_066964.1). KKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Specificity
Human XRCC5 / Ku80
Applications
  • IHC (1:100 - 1:200)
  • Immunofluorescence (1:20 - 1:100)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 82kDa, while the observed MW by Western blot was 100kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About XRCC5 / Ku80
P13010 NM_021141 NP_066964.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/9/2022