Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
XPO1 / CRM1 Antibody LS‑C330908
CRM1 antibody LS-C330908 is an unconjugated rabbit polyclonal antibody to CRM1 (XPO1) from human and mouse. Validated for WB.
50 µl
100 µl
200 µl

Popular XPO1 / CRM1 Products

Anti-CRM1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1776 concentration 10 ug/ml.
Species: Human, Monkey, Bat, Bovine, Dog, Horse, Chicken, Xenopus
Applications: IHC, IHC - Paraffin, Western blot
Fetal heart cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 6%-18%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Chicken, Xenopus
Applications: Western blot
Anti-XPO1 / CRM1 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B11039 dilution 1:100.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence
Anti-XPO1 / CRM1 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B11299 concentration 5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation, Proximity Ligation Assay
Immunohistochemistry of paraffin-embedded human pancreatic tissue using CSB-PA026221LA01HU at dilution of 1:100
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, ELISA

Product Description

CRM1 antibody LS-C330908 is an unconjugated rabbit polyclonal antibody to CRM1 (XPO1) from human and mouse. Validated for WB.
About XPO1 / CRM1
Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. O14980 NM_003400 NP_003391.1

XPO1 Antibody, CRM1, yeast, homolog Antibody, Exp1 Antibody, Exportin-1 Antibody, CRM1 Antibody


Human XPO1 / CRM1
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
XPO1 / CRM1 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO1 (NP_003391.1). GLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
Human XPO1 / CRM1
The predicted MW is 123kDa, while the observed MW by Western blot was 123kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of HeLa cells.
Western blot analysis of extracts of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of HeLa cells.
Western blot analysis of extracts of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of HeLa cells.
Western blot analysis of extracts of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of HeLa cells.
Western blot analysis of extracts of HeLa cells.

Requested From: United States
Date Requested: 9/23/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy