LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

XPO1 / CRM1 Antibody LS‑C330908

Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of HeLa cells.
Western blot analysis of extracts of various cell lines, using XPO1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of HeLa cells.
1 of 2
2 of 2

XPO1 / CRM1 Antibody LS‑C330908

Antibody:
Rabbit Polyclonal to Human XPO1 / CRM1
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C330908-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human XPO1 / CRM1
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
CRM1 antibody LS-C330908 is an unconjugated rabbit polyclonal antibody to CRM1 (XPO1) from human and mouse. Validated for WB.
Target
Human XPO1 / CRM1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
XPO1 / CRM1 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO1 (NP_003391.1). GLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
Specificity
Human XPO1 / CRM1
Usage
The predicted MW is 123kDa, while the observed MW by Western blot was 123kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About XPO1 / CRM1
O14980 NM_003400 NP_003391.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 15.6-1000 pg/ml
Reactivity: All species
Range: 0.78-50 ng/ml
Anti-FPR1 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Mouse
Range: 0.312-20 ng/ml
Anti-LAG-3 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, IHC - Paraffin, Flow Cytometry

Requested From: United States
Date Requested: 7/21/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy