Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
WC1 / ATP7B Antibody LS‑C662011
ATP7B antibody LS-C662011 is an unconjugated rabbit polyclonal antibody to human ATP7B (WC1). Validated for IHC and WB.
100 µg

Popular WC1 / ATP7B Products

Anti-ATP7B antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2302 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
ATP7B Antibody IHC of formalin-fixed and paraffin-embedded mouse brain tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
Anti-ATP7B antibody IHC of human lung, respiratory epithelium. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6888 dilution 1:100.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Peptide Enzyme-Linked Immunosorbent Assay
Anti-WC1 / ATP7B antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B10916 concentration 10 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
WC1 / ATP7B antibody. IHC(P): Rat Kidney Tissue.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot

Product Description

WC1 / ATP7B Antibody for IHC, WB/Western LS-C662011


Human WC1 / ATP7B
ATP7B, Copper-transporting ATPase 2, WC1, Wilson disease, PWD, WD, Copper pump 2, WND
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
WC1 / ATP7B antibody was raised against a synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
Most abundant in liver and kidney and also found in brain. Isoform 2 is expressed in brain but not in liver. The cleaved form WND/140 kDa is found in liver cell lines and other tissues.
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About WC1 / ATP7B
WC1 / ATP7B is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. P35670 NM_000053 NP_000044.2

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Western blot

Western blot - Anti-ATP7b Picoband Antibody
Western blot - Anti-ATP7b Picoband Antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Western blot

Western blot - Anti-ATP7b Picoband Antibody
Western blot - Anti-ATP7b Picoband Antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Western blot

Western blot - Anti-ATP7b Picoband Antibody
Western blot - Anti-ATP7b Picoband Antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Immunohistochemistry - Paraffin

ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody

Western blot

Western blot - Anti-ATP7b Picoband Antibody
Western blot - Anti-ATP7b Picoband Antibody

Requested From: United States
Date Requested: 10/20/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy