Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

VIPR1 Antibody LS-C497226

VIPR1 antibody LS-C497226 is an unconjugated rabbit polyclonal antibody to VIPR1 from human and rat. Validated for WB.
50 µl
100 µl
VIPR1 antibody LS-C497226 is an unconjugated rabbit polyclonal antibody to VIPR1 from human and rat. Validated for WB.
Human VIPR1
Human, Rat (tested or 100% immunogen sequence identity)
  • Western blot
VIPR1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human VIPR1 (NP_004615.2). ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY
The predicted MW is 28kDa/46kDa/47kDa/51kDa/55kDa, while the observed MW by Western blot was 51kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
For research use only.
About VIPR1
P32241 NM_004624 NP_004615.2

Popular VIPR1 Products

Anti-VIP Receptor 1 antibody IHC of human adrenal medulla. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Anti-VIP Receptor 1 antibody IHC of human adipocytes. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin
Immunofluorescence of MCF7 cells, using VIPR1 Antibody. The picture on the right is treated with the synthesized peptide.
Species: Human, Mouse, Rat
Applications: Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Mouse
Applications: Western blot, ELISA
Western blot of VPAC1 (V371) pAb in extracts from HT-29 cells.
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

Western blot

Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

Western blot

Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

Western blot

Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
Western blot analysis of extracts of Raji cells, using VIPR1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

Requested From: United States
Date Requested: 3/21/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy