Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

UCN2 / SRP Antibody LS‑C335681

Catalog Number Size Price
LS-C335681-50 50 µl $235 
LS-C335681-100 100 µl $315 
LS-C335681-200 200 µl $425 
Immunohistochemistry of paraffin-embedded mouse heart.
Immunofluorescence analysis of U2OS cells.
Western blot analysis of extracts of rat skin cells.
Immunohistochemistry of paraffin-embedded mouse heart.
Immunofluorescence analysis of U2OS cells.
Western blot analysis of extracts of rat skin cells.
1 of 3
2 of 3
3 of 3

UCN2 / SRP Antibody LS‑C335681

Antibody:
Rabbit Polyclonal to Human UCN2 / SRP
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C335681-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human UCN2 / SRP
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
SRP antibody LS-C335681 is an unconjugated rabbit polyclonal antibody to SRP (UCN2 ) from human, mouse and rat. Validated for IF, IHC and WB.
Target
Human UCN2 / SRP
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
Specificity
Human UCN2 / SRP
Usage
The predicted MW is 12kDa, while the observed MW by Western blot was 12kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About UCN2 / SRP
Q96RP3 NM_033199 NP_149976.1

Publications (0)

Reviews (0)

Featured Products

Product
Species: Human
Applications: ELISA
Western Blot; Sample: Human Urine; Primary Ab: 2µg/ml Rabbit Anti-Human UCN2 Antibody Second Ab: 0.2µg/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody
Species: Human, Rat, Bovine, Pig
Applications: Western blot
Western Blot; Sample: Recombinant UCN2, Human.
Species: Human
Applications: Western blot
Western Blot; Sample: Recombinant UCN2, Rat.
Species: Rat
Applications: Western blot
Product
Species: Human
Applications: ELISA
Reactivity: Human
Range: 7.8-500 pg/ml

Requested From: United States
Date Requested: 9/15/2019