LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
TSPAN7 / CD231 Antibody LS‑C334700
CD231 antibody LS-C334700 is an unconjugated rabbit polyclonal antibody to rat CD231 (TSPAN7). Validated for WB.
Catalog
Size
Price
LS-C334700-50
50 µl
$235
LS-C334700-100
100 µl
$315
LS-C334700-200
200 µl
$425

Popular TSPAN7 / CD231 Products

Western blot of TSPAN7 Antibody in CEM cell line lysates (35 ug/lane). TSPAN7 (arrow) was detected using the purified antibody.
Species: Human
Applications: Western blot, Flow Cytometry
Antibody
Species: Human
Applications: Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, Flow Cytometry, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Immunoprecipitation, ELISA
Immunofluorescence Image
Species: Human
Applications: ICC, Immunofluorescence, Western blot

Product Description

CD231 antibody LS-C334700 is an unconjugated rabbit polyclonal antibody to rat CD231 (TSPAN7). Validated for WB.
About TSPAN7 / CD231
TSPAN7 / CD231 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. P41732 NM_004615 NP_004606.2

TSPAN7 Antibody, A15 Antibody, CD231 antigen Antibody, Cell surface glycoprotein A15 Antibody, CD231 Antibody, DXS1692E Antibody, MXS1 Antibody, TALLA-1 Antibody, Tetraspanin 7 Antibody, Transmembrane protein A15 Antibody, Tetraspanin protein Antibody, Tspan-7 Antibody, TM4SF2 Antibody, CCG-B7 Antibody, MRX58 Antibody, Tetraspanin-7 Antibody, TM4SF2b Antibody, Transmembrane 4 superfamily 2b Antibody


Specifications

Target
Human TSPAN7 / CD231
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
TSPAN7 / CD231 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 113-213 of human TSPAN7 (NP_004606.2). RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Specificity
Human and rat TSPAN7 / CD231.
Usage
The predicted MW is 27kDa, while the observed MW by Western blot was 38kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 8/16/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number