Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C750079-20 20 µl $253 
LS-C750079-50 50 µl $279 
LS-C750079-100 100 µl $333 
LS-C750079-200 200 µl $429 
TRAF3 Antibody - Immunofluorescence analysis of U2OS cells using TRAF3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Polyclonal Rabbit anti‑Human TRAF3 Antibody (IF, WB) LS‑C750079

Polyclonal Rabbit anti‑Human TRAF3 Antibody (IF, WB) LS‑C750079

Antibody:
TRAF3 Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C750079-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
TRAF3 Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TRAF3 antibody LS-C750079 is an unconjugated rabbit polyclonal antibody to TRAF3 from human. It is reactive with human, mouse and rat. Validated for IF and WB.
Target
Human TRAF3
Synonyms
TRAF3 | CAP-1 | CD40 associated protein 1 | CD40 binding protein | CRAF1 | LMP1 | LMP1-associated protein 1 | IIAE5 | CD40-binding protein | CD40bp | LAP1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAF3 (NP_003291.2). MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV
Applications
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 55kDa/64kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TRAF3
Q13114 NM_145725 NP_663777.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/6/2021