Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
TOPBP1 Antibody LS‑C747670
TOPBP1 antibody LS-C747670 is an unconjugated rabbit polyclonal antibody to TOPBP1 from human, mouse and rat. Validated for IHC and WB.
50 µl
TOPBP1 antibody LS-C747670 is an unconjugated rabbit polyclonal antibody to TOPBP1 from human, mouse and rat. Validated for IHC and WB.
Human TOPBP1
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
TOPBP1 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOPBP1 (NP_008958.2). MSRNDKEPFFVKFLKSSDNSKCFFKALESIKEFQSEEYLQIITEEEALKIKENDRSLYICDPFSGVVFDHLKKLGCRIVGPQVVIFCMHHQRCVPRAEHP
The predicted MW is 170kDa, while the observed MW by Western blot was 170kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About TOPBP1
Q92547 NM_007027 NP_008958.2

Popular TOPBP1 Products

Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunohistochemistry of paraffin-embedded human gastric cancer tissue.
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot
Immunohistochemistry of paraffin-embedded human placenta tissue using antibody at 1:100 dilution.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Species: Human
Applications: ICC, Western blot

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.


Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.


Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.


Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat lung using TOPBP1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using TOPBP1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using TOPBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Requested From: United States
Date Requested: 11/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy