Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C132460-20 20 µl $415 
LS-C132460-100 100 µl $830 

TMSB15 Antibody (aa1‑45) LS‑C132460

TMSB15 Antibody (aa1‑45) LS‑C132460

Rabbit Polyclonal to Human TMSB15
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human TMSB15
Human, Mouse
Unconjugated, Unmodified


TMSB15 antibody LS-C132460 is an unconjugated rabbit polyclonal antibody to TMSB15 from human and mouse. Validated for ELISA and WB.
Human TMSB15
Human, Mouse (tested or 100% immunogen sequence identity)
  • Western blot
  • ELISA (1:50000 - 1:75000)
Synthetic human Thymosin b15 (aa 1-45) KLH conjugated(MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS). Percent identity by BLAST analysis: Mouse (100%); Rat (87%); Rabbit, Pig (84%); Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Platypus (81%).
Recognizes human Thymosin b15 (aa 1-45).
Suitable for use in ELISA, Western Blot. ELISA: 1:50000-1:75000.
Reconstitute in sterile distilled water.
Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee

Publications (0)

Reviews (0)

Featured Products

IL2RA / CD25 Antibody - Immunofluorescence analysis of HeLa cells, using IL-2R alpha/CD25 (Phospho-Ser268) Antibody. The picture on the right is blocked with the phospho peptide.
Species: Human
Applications: Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Mouse
Range: 78-5000 pg/ml
IAPP / Amylin Antibody - Anti-Amylin antibody IHC of human pancreas, islet of Langerhans. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Immunofluorescence

Requested From: United States
Date Requested: 10/20/2019