Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331538-20 20 µl $263 
LS-C331538-50 50 µl (1.36 mg/ml) $301 
LS-C331538-100 100 µl (1.36 mg/ml) $359 
LS-C331538-200 200 µl $473 
TIMP2 Antibody - Immunofluorescence analysis of MCF-7 cells using TIMP2 antibody. Blue: DAPI for nuclear staining.
TIMP2 Antibody - Western blot analysis of extracts of SW480 cell lines.
TIMP2 Antibody - Western blot analysis of extracts of various cell lines, using TIMP2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
TIMP2 Antibody - Immunofluorescence analysis of MCF-7 cells using TIMP2 antibody. Blue: DAPI for nuclear staining.
TIMP2 Antibody - Western blot analysis of extracts of SW480 cell lines.
TIMP2 Antibody - Western blot analysis of extracts of various cell lines, using TIMP2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human TIMP2 Antibody (IHC, IF, WB) LS‑C331538

Polyclonal Rabbit anti‑Human TIMP2 Antibody (IHC, IF, WB) LS‑C331538

Antibody:
TIMP2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331538-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
TIMP2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TIMP2 antibody LS-C331538 is an unconjugated rabbit polyclonal antibody to TIMP2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human TIMP2
Synonyms
TIMP2 | Metalloproteinase inhibitor 2 | TIMP-2 | CSC-21K
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIMP2 (NP_003246.1). VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
Specificity
Human TIMP2
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 24kDa, while the observed MW by Western blot was 24kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TIMP2
P16035 NM_003255 NP_003246.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/8/2022