Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334145-20 20 µl $263 
LS-C334145-50 50 µl $301 
LS-C334145-100 100 µl $359 
LS-C334145-200 200 µl $473 
TACR1 / NK1R Antibody - Western blot analysis of extracts of various cell lines.

Polyclonal Rabbit anti‑Human TACR1 / NK1R Antibody (IHC, WB) LS‑C334145

Polyclonal Rabbit anti‑Human TACR1 / NK1R Antibody (IHC, WB) LS‑C334145

TACR1 / NK1R Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


TACR1 / NK1R Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


NK1R antibody LS-C334145 is an unconjugated rabbit polyclonal antibody to NK1R (TACR1) from human. It is reactive with human and mouse. Validated for IHC and WB.
Human TACR1 / NK1R
TACR1 | Neurokinin receptor 1 | NK-1R | Nk1 tachykinin receptor | NK1R | TAC1R | Tachykinin 1 receptor | NKIR | Substance-P receptor | Neurokinin 1 receptor | NK-1 receptor | Tachykinin receptor 1
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 308-407 of human TACR1 (NP_001049.1). LNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
Human TACR1 / NK1R
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 35kDa/46kDa, while the observed MW by Western blot was 40kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TACR1 / NK1R
P25103 NM_001058 NP_001049.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 12/9/2022