Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C332176-20 20 µl $263 
LS-C332176-50 50 µl $301 
LS-C332176-100 100 µl $359 
LS-C332176-200 200 µl $473 
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human esophagus using SUMO2 antibody at dilution of 1:100 (200x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung using SUMO2 antibody at dilution of 1:100 (400x lens).
SUMO2 Antibody - Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.
SUMO2 Antibody - Western blot analysis of extracts of various cell lines, using SUMO2 antibody.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung tissue.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human esophagus using SUMO2 antibody at dilution of 1:100 (200x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung using SUMO2 antibody at dilution of 1:100 (400x lens).
SUMO2 Antibody - Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.
SUMO2 Antibody - Western blot analysis of extracts of various cell lines, using SUMO2 antibody.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human SUMO2 Antibody (IHC, IF, WB) LS‑C332176

Polyclonal Rabbit anti‑Human SUMO2 Antibody (IHC, IF, WB) LS‑C332176

Antibody:
SUMO2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C332176-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SUMO2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
SUMO2 antibody LS-C332176 is an unconjugated rabbit polyclonal antibody to SUMO2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human SUMO2
Synonyms
SUMO2 | HSMT3 | SMT3 homolog 2 | SMT3A | Sentrin 2 | Smt3B | SMT3H2 | SUMO-2 | SUMO-3 | Sentrin-2 | Ubiquitin-like protein SMT3A | Ubiquitin-like protein SMT3B
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Specificity
Human SUMO2/3.
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 8kDa/10kDa, while the observed MW by Western blot was 17kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SUMO2
P61956 NM_006937 NP_008868.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022