Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C750543-20 20 µl $253 
LS-C750543-50 50 µl $279 
LS-C750543-100 100 µl $333 
LS-C750543-200 200 µl $429 

Polyclonal Rabbit anti‑Human STT3B Antibody (WB) LS‑C750543

Polyclonal Rabbit anti‑Human STT3B Antibody (WB) LS‑C750543

STT3B Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


STT3B Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


STT3B antibody LS-C750543 is an unconjugated rabbit polyclonal antibody to STT3B from human. It is reactive with human and mouse. Validated for WB.
Human STT3B
STT3B | Homolog of yeast STT3 | Oligosaccharyl transferase 3 | SIMP | STT3-B
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 747-826 of human STT3B (NP_849193.1). GNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV
  • Western blot (1:200 - 1:2000)
The predicted MW is 93kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About STT3B
Q8TCJ2 NM_178862 NP_849193.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/6/2021