Human STAT3

Rabbit

Human, Monkey, Mouse, Rat, Bovine, Hamster, Horse, Pig (tested or 100% immunogen sequence identity)

IgG Polyclonal

Unconjugated. Also available conjugated with APC, Biotin, FITC, HRP, PE, AF647, CF, PE.

Protein A purified

Unmodified

Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).

aa688-722

Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.

• ICC (10 µg/ml)
• Western blot (2 - 4 µg/ml)
• Immunoprecipitation
• Gel shift

Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 ug/ml shows positive immunostaining for STAT 3 in A431 cells fixed with 95% ethanol, 5% acetic acid. Immunoprecipitation: 4 ug immunoprecipitates STAT 3 from 500 ug of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.

0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.

Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: P40763 NCBI: NM_003150 NP_003141.2