LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

SPP1 / Osteopontin Antibody (aa281-314) LS-C408135

Osteopontin antibody Western blot. All lanes: Anti Osteopontin at 0.5 ug/ml. Lane 1: Mouse Pancreas Tissue Lysate at 50 ug. Lane 2: JURKAT Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.

SPP1 / Osteopontin Antibody (aa281-314) LS-C408135

Antibody:
Rabbit Polyclonal to Human SPP1 / Osteopontin
Application:
WB, ELISA
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$325 
LS-C408135-100
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human SPP1 / Osteopontin
Application:
WB, ELISA
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Osteopontin antibody LS-C408135 is an unconjugated rabbit polyclonal antibody to Osteopontin (SPP1) from human, mouse and rat. Validated for ELISA and WB.

Target
Human SPP1 / Osteopontin
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Epitope
aa281-314
Specificity
Bone. Found in plasma.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute in 200 ul distilled water
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SPP1 / Osteopontin
P10451 NM_000582 NP_000573.1

Publications (0)

Reviews (0)

Featured Products

Product
Species: Human
Applications: Western blot, ELISA
Reactivity: Human
Range: 0.156-10 ng/ml

Requested From: United States
Date Requested: 6/18/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy