Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331420-20 20 µl $287 
LS-C331420-50 50 µl $329 
LS-C331420-100 100 µl $407 
LS-C331420-200 200 µl $509 
SOD2 / Mn SOD Antibody - Immunohistochemistry of paraffin-embedded human oophoroma using SOD2 antibodyat dilution of 1:100 (40x lens).
SOD2 / Mn SOD Antibody - Immunohistochemistry of paraffin-embedded rat heart using SOD2 antibodyat dilution of 1:100 (40x lens).
SOD2 / Mn SOD Antibody - Immunofluorescence analysis of PC-12 cells using SOD2 antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
SOD2 / Mn SOD Antibody - Immunofluorescence analysis of HeLa cells using SOD2 antibody. Blue: DAPI for nuclear staining.
SOD2 / Mn SOD Antibody - Western blot analysis of extracts of various cell lines, using SOD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
SOD2 / Mn SOD Antibody - Immunohistochemistry of paraffin-embedded human oophoroma using SOD2 antibodyat dilution of 1:100 (40x lens).
SOD2 / Mn SOD Antibody - Immunohistochemistry of paraffin-embedded rat heart using SOD2 antibodyat dilution of 1:100 (40x lens).
SOD2 / Mn SOD Antibody - Immunofluorescence analysis of PC-12 cells using SOD2 antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
SOD2 / Mn SOD Antibody - Immunofluorescence analysis of HeLa cells using SOD2 antibody. Blue: DAPI for nuclear staining.
SOD2 / Mn SOD Antibody - Western blot analysis of extracts of various cell lines, using SOD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human SOD2 / Mn SOD Antibody (IHC, IF, WB) LS‑C331420

Polyclonal Rabbit anti‑Human SOD2 / Mn SOD Antibody (IHC, IF, WB) LS‑C331420

Antibody:
SOD2 / Mn SOD Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C331420-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SOD2 / Mn SOD Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Mn SOD antibody LS-C331420 is an unconjugated rabbit polyclonal antibody to Mn SOD (SOD2) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human SOD2 / Mn SOD
Synonyms
SOD2 | IPOB | MVCD6 | Indophenoloxidase B | Mn superoxide dismutase | MNSOD | Mangano-superoxide dismutase
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2). KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Specificity
Human MNSOD / SOD2
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 18kDa/19kDa/20kDa/24kDa, while the observed MW by Western blot was 23kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SOD2 / Mn SOD
P04179 NM_000636 NP_000627.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/8/2022