Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331227-20 20 µl $263 
LS-C331227-50 50 µl $301 
LS-C331227-100 100 µl (1.88 mg/ml) $359 
LS-C331227-200 200 µl $473 
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded rat brain using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded rat spleen using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human liver injury using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human lung cancer tissue.
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human stomach cancer tissue.
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded Human liver injury tissue.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of A549 cells.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of A549 cells using SNAI2 antibody. Blue: DAPI for nuclear staining.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of MCF7 cells.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of U2OS cells.
SNAI2 / SLUG Antibody - Western blot analysis of extracts of various cell lines, using SNAI2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
SNAI2 / SLUG Antibody - Western blot analysis of pancreas cell lysate.
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded rat brain using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded rat spleen using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human liver injury using SNAI2 Antibodyat dilution of 1:100 (40x lens).
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human lung cancer tissue.
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded human stomach cancer tissue.
SNAI2 / SLUG Antibody - Immunohistochemistry of paraffin-embedded Human liver injury tissue.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of A549 cells.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of A549 cells using SNAI2 antibody. Blue: DAPI for nuclear staining.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of MCF7 cells.
SNAI2 / SLUG Antibody - Immunofluorescence analysis of U2OS cells.
SNAI2 / SLUG Antibody - Western blot analysis of extracts of various cell lines, using SNAI2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
SNAI2 / SLUG Antibody - Western blot analysis of pancreas cell lysate.
1 of 13
2 of 13
3 of 13
4 of 13
5 of 13
6 of 13
7 of 13
8 of 13
9 of 13
10 of 13
11 of 13
12 of 13
13 of 13

Polyclonal Rabbit anti‑Human SNAI2 / SLUG Antibody (IHC, IF, WB) LS‑C331227

Polyclonal Rabbit anti‑Human SNAI2 / SLUG Antibody (IHC, IF, WB) LS‑C331227

Antibody:
SNAI2 / SLUG Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331227-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SNAI2 / SLUG Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
SLUG antibody LS-C331227 is an unconjugated rabbit polyclonal antibody to SLUG (SNAI2) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human SNAI2 / SLUG
Synonyms
SNAI2 | SLUG | SLUGH1 | Snail homolog 2 (Drosophila) | SNAIL2 | SLUGH | Protein snail homolog 2 | WS2D | Zinc finger protein SNAI2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 89-268 of human SNAI2 (NP_003059.1). PPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Specificity
Human SNAI2 / SLUG
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 29kDa, while the observed MW by Western blot was 27kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SNAI2 / SLUG
O43623 NM_003068 NP_003059.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022