LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

SNAI2 / SLUG Antibody (aa116-148) LS-C407652

SLUG antibody LS-C407652 is an unconjugated rabbit polyclonal antibody to SLUG (SNAI2) from human, mouse, rat and other species. Validated for IHC and WB.
Catalog
Size
Price
LS-C407652-100
100 µg
$325
Description
SLUG antibody LS-C407652 is an unconjugated rabbit polyclonal antibody to SLUG (SNAI2) from human, mouse, rat and other species. Validated for IHC and WB.
Target
Human SNAI2 / SLUG
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Dog, Guinea pig, Hamster, Horse, Rabbit (tested or 100% immunogen sequence identity)
Predicted
Hamster (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
SNAI2 / SLUG antibody was raised against a synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.
Epitope
aa116-148
Specificity
Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level). .
Usage
WB: The detection limit for SLUG is approximately 0.1 ng/lane under reducing conditions. IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About SNAI2 / SLUG
O43623 NM_003068 NP_003059.1

Popular SNAI2 / SLUG Products

Anti-SNAI2 / SLUG antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot, ELISA
IHC of paraffin-embedded Human lymphoma tissue using anti-SNAI2 mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Anti-SNAI2 / SLUG antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
IHC of paraffin-embedded Human pancreas tissue using anti-SNAI2 mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
Western blot analysis of SLUG expression in HEK293T (A); Raw264.7 (B); PC12 (C) whole cell lysates.
Species: Human, Mouse, Rat, Bovine, Pig, Sheep
Applications: Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.

Western blot

SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.
SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.

Western blot

SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.
SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.

Western blot

SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.
SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Rat Cardiac Muscle Tissue.

Immunohistochemistry

SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.
SL ug antibody IHC-paraffin. IHC(P): Mouse Cardiac Muscle Tissue.

Western blot

SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.
SL ug antibody Western blot. All lanes: Anti SL ug at 0.5 ug/ml. Lane 1: Mouse Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Lung Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Lane 4: Mouse Brain Tissue Lysate at 50 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 30 kD. Observed band size: 39 kD.

Requested From: United States
Date Requested: 2/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy