LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
SLC7A11 / XCT Antibody LS‑C748722
XCT antibody LS-C748722 is an unconjugated rabbit polyclonal antibody to XCT (SLC7A11) from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C748722-50
50 µl
$235
Description
XCT antibody LS-C748722 is an unconjugated rabbit polyclonal antibody to XCT (SLC7A11) from human, mouse and rat. Validated for WB.
Target
Human SLC7A11 / XCT
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
SLC7A11 / XCT antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11 (NP_055146.1). ILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWF
Usage
The predicted MW is 55kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About SLC7A11 / XCT
Q9UPY5 NM_014331 NP_055146.1

Popular SLC7A11 / XCT Products

Anti-SLC7A11 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Anti-SLC7A11 antibody IHC of human chief cells. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
Anti-SLC7A11 antibody IHC of human stomach. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
SLC7A11 antibody Western blot of THP-1 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Pig
Applications: Western blot
Detection of XCT in total human stomach lysate using NB 300-317. 15 minute ECL exposure.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Western blot, Flow Cytometry

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/16/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy