Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331555-20 20 µl $263 
LS-C331555-50 50 µl $301 
LS-C331555-100 100 µl (0.48 mg/ml) $359 
LS-C331555-200 200 µl $473 
SIN3A Antibody - Immunofluorescence analysis of U2OS cells using SIN3A antibody. Blue: DAPI for nuclear staining.
SIN3A Antibody - Western blot analysis of extracts of various cell lines, using SIN3A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
SIN3A Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug SIN3A antibody. Western blot was performed from the immunoprecipitate using SIN3A antibodyat a dilition of 1:500.
SIN3A Antibody - Immunofluorescence analysis of U2OS cells using SIN3A antibody. Blue: DAPI for nuclear staining.
SIN3A Antibody - Western blot analysis of extracts of various cell lines, using SIN3A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
SIN3A Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug SIN3A antibody. Western blot was performed from the immunoprecipitate using SIN3A antibodyat a dilition of 1:500.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human SIN3A Antibody (IHC, IF, WB) LS‑C331555

Polyclonal Rabbit anti‑Human SIN3A Antibody (IHC, IF, WB) LS‑C331555

Antibody:
SIN3A Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331555-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SIN3A Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
SIN3A antibody LS-C331555 is an unconjugated rabbit polyclonal antibody to SIN3A from human. It is reactive with human and mouse. Validated for ChIP-Seq, IF, IHC, IP and WB. Cited in 1 publication.
Target
Human SIN3A
Synonyms
SIN3A | DKFZP434K2235 | KIAA0700
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SIN3A (NP_056292.1). MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
Specificity
Human SIN3A
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:100)
  • ChIP-sequencing (1:20 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 145kDa, while the observed MW by Western blot was 165kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SIN3A
Q96ST3 NM_015477 NP_056292.1

LSBio Ratings

SIN3A Antibody for IHC, IF/Immunofluorescence, WB/Western, IP LS-C331555 has an LSBio Rating of
Publications (4)

Publications (1)

Coregulator Sin3a Promotes Postnatal Murine ß-Cell Fitness by Regulating Genes in Ca2+ Homeostasis, Cell Survival, Vesicle Biosynthesis, Glucose Metabolism, and Stress Response. Xiaodun Yang, Sarah M Graff, Cody N Heiser, Kung-Hsien Ho, Bob Chen, Alan J Simmons, Austin N Southard-Smith, Gregory David, David A Jacobson, Irina Kaverina, Christopher V E Wright, Ken S Lau, Guoqiang Gu. Diabetes. 2020 June;69:1219-1231.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022