Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C749915-20 20 µl $253 
LS-C749915-50 50 µl $279 
LS-C749915-100 100 µl $333 
LS-C749915-200 200 µl $429 
Antibody

Polyclonal Rabbit anti‑Human SEMA6D / Semaphorin 6D Antibody (WB) LS‑C749915

Polyclonal Rabbit anti‑Human SEMA6D / Semaphorin 6D Antibody (WB) LS‑C749915

Antibody:
SEMA6D / Semaphorin 6D Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C749915-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
SEMA6D / Semaphorin 6D Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Semaphorin 6D antibody LS-C749915 is an unconjugated rabbit polyclonal antibody to Semaphorin 6D (SEMA6D) from human. It is reactive with human and mouse. Validated for WB.
Target
Human SEMA6D / Semaphorin 6D
Synonyms
SEMA6D | KIAA1479 | Semaphorin-6D
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SEMA6D (NP_705871.1). AVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAM
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 54kDa/67kDa/111-119kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SEMA6D / Semaphorin 6D
Q8NFY4 NM_024966 NP_079242.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/12/2021