Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C750284-20 20 µl $253 
LS-C750284-50 50 µl $279 
LS-C750284-100 100 µl $333 
LS-C750284-200 200 µl $429 
S100A8 / MRP8 Antibody - Western blot analysis of extracts of various cell lines, using S100A8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Polyclonal Rabbit anti‑Human S100A8 / MRP8 Antibody (WB) LS‑C750284

Polyclonal Rabbit anti‑Human S100A8 / MRP8 Antibody (WB) LS‑C750284

S100A8 / MRP8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


S100A8 / MRP8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


MRP8 antibody LS-C750284 is an unconjugated rabbit polyclonal antibody to MRP8 (S100A8) from human. It is reactive with human and mouse. Validated for WB.
Human S100A8 / MRP8
S100A8 | 60B8AG | CFAG | CAGA | Calgranulin A | Calgranulin-A | Calprotectin L1L subunit | Cystic fibrosis antigen | CGLA | L1Ag | NIF | p8 | Protein S100-A8 | MRP8 | Urinary stone protein band A | CP-10 | MA387 | MRP-8
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human S100A8 (NP_002955.2). MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
  • Western blot (1:500 - 1:2000)
The predicted MW is 10kDa, while the observed MW by Western blot was 11kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About S100A8 / MRP8
P05109 NM_002964 NP_002955.2

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/11/2021