Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C749651-20 20 µl $253 
LS-C749651-50 50 µl (0.47 mg/ml) $279 
LS-C749651-100 100 µl $333 
LS-C749651-200 200 µl $429 
S100A10 Antibody - Immunohistochemistry of paraffin-embedded mouse testis using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human mammary cancer using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded mouse leydig cells using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded rat ovary using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human colon using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Western blot analysis of extracts of various cell lines, using S100A10 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
S100A10 Antibody - Immunohistochemistry of paraffin-embedded mouse testis using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human mammary cancer using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded mouse leydig cells using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded rat ovary using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human colon using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using S100A10 antibody at dilution of 1:100 (40x lens).
S100A10 Antibody - Western blot analysis of extracts of various cell lines, using S100A10 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human S100A10 Antibody (IHC, WB) LS‑C749651

Polyclonal Rabbit anti‑Human S100A10 Antibody (IHC, WB) LS‑C749651

Antibody:
S100A10 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Monkey, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C749651-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
S100A10 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Monkey, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
S100A10 antibody LS-C749651 is an unconjugated rabbit polyclonal antibody to S100A10 from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human S100A10
Synonyms
S100A10 | 42C | ANX2LG | Calpactin-1 light chain | Calpactin I light chain | CLP11 | p11 | p10 | p10 protein | Protein S100-A10 | ANX2L | Ca[1] | CAL1L | Cellular ligand of annexin II | gp11
Host
Rabbit
Reactivity
Human, Monkey, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1). MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 11kDa, while the observed MW by Western blot was 11kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About S100A10
P60903 NM_002966 NP_002957.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/15/2021