Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334726-20 20 µl $263 
LS-C334726-50 50 µl $301 
LS-C334726-100 100 µl $359 
LS-C334726-200 200 µl $473 
RAMP1 Antibody - Western blot analysis of extracts of various cell lines.

Polyclonal Rabbit anti‑Human RAMP1 Antibody (WB) LS‑C334726

Polyclonal Rabbit anti‑Human RAMP1 Antibody (WB) LS‑C334726

RAMP1 Rabbit anti-Human Polyclonal Antibody
Human, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


RAMP1 Rabbit anti-Human Polyclonal Antibody
Human, Rat
Unconjugated, Unmodified


RAMP1 antibody LS-C334726 is an unconjugated rabbit polyclonal antibody to RAMP1 from human. It is reactive with human and rat. Validated for WB.
Human RAMP1
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 27-117 of human RAMP1 (NP_005846.1). CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
Human RAMP1
  • Western blot (1:500 - 1:2000)
The predicted MW is 16kDa, while the observed MW by Western blot was 18kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About RAMP1
O60894 NM_005855 NP_005846.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 12/6/2022