Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C132511-20 20 µl $405 
LS-C132511-100 100 µl $740 

PTH2 / Parathyroid Hormone 2 Antibody (aa62‑100) LS‑C132511

PTH2 / Parathyroid Hormone 2 Antibody (aa62‑100) LS‑C132511

Rabbit Polyclonal to Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig
Unconjugated, Unmodified


Parathyroid Hormone 2 antibody LS-C132511 is an unconjugated rabbit polyclonal antibody to Parathyroid Hormone 2 (PTH2 ) from human, bovine, dog and other species. Validated for ELISA and RIA.
Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig (tested or 100% immunogen sequence identity)
  • ELISA (1:2000 - 1:4000)
  • Radioimmunoassay (1:2)
Synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bovine, Pig (100%); Marmoset, Horse (97%); Elephant (94%); Mouse, Rat, Rabbit (90%).
Recognizes human TIP 39 (aa 62-100). Species cross-reactivity: bovine, canine.
Suitable for use in RIA. ELISA: 1:2000-1:4000. RIA: 1:2.000.
Lyophilized from PBS, pH 7.2
Sterile 40-50% glycerol.
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PTH2 / Parathyroid Hormone 2
Q96A98 Q96A98

Publications (0)

Reviews (0)

Featured Products

PTH2 / Parathyroid Hormone 2 Antibody - HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 10-20%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Applications: Western blot
PTH2 / Parathyroid Hormone 2 Antibody - HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 10-20%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Applications: Western blot
PTH2 / Parathyroid Hormone 2 Antibody - HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 10-20%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Applications: Western blot
PTH2 / Parathyroid Hormone 2 Antibody - HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 10-20%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Applications: Western blot

Requested From: United States
Date Requested: 10/22/2019