Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756673-10 10 µg $318 
LS-C756673-100 100 µg $470 
PRKAB2 / AMPK Beta 2 Antibody - Western blot analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. Electrophoresis was performed on a 10% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate, Lane 2: human placenta tissue lysate,Lane 3: human 293T whole cell lysate,Lane 4: human A549 whole cell lysate,Lane 5: human A375 whole cell lysate,Lane 6: human A431 whole cell lysate,Lane 7: human U20S whole cell lysate,Lane 8: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-AMPK beta 2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
PRKAB2 / AMPK Beta 2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-AMPK beta 2 antibody. Overlay histogram showing PC-3 cells stained with anti-AMPK beta 2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-AMPK beta 2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PRKAB2 / AMPK Beta 2 Antibody - Western blot analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. Electrophoresis was performed on a 10% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate, Lane 2: human placenta tissue lysate,Lane 3: human 293T whole cell lysate,Lane 4: human A549 whole cell lysate,Lane 5: human A375 whole cell lysate,Lane 6: human A431 whole cell lysate,Lane 7: human U20S whole cell lysate,Lane 8: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-AMPK beta 2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
PRKAB2 / AMPK Beta 2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-AMPK beta 2 antibody. Overlay histogram showing PC-3 cells stained with anti-AMPK beta 2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-AMPK beta 2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 2
2 of 2

Monoclonal Mouse anti‑Human PRKAB2 / AMPK Beta 2 Antibody (IHC, WB) LS‑C756673

Monoclonal Mouse anti‑Human PRKAB2 / AMPK Beta 2 Antibody (IHC, WB) LS‑C756673

Antibody:
PRKAB2 / AMPK Beta 2 Mouse anti-Human Monoclonal Antibody
Application:
IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756673-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PRKAB2 / AMPK Beta 2 Mouse anti-Human Monoclonal Antibody
Application:
IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
AMPK Beta 2 antibody LS-C756673 is an unconjugated mouse monoclonal antibody to human AMPK Beta 2 (PRKAB2). Validated for Flow, ICC, IHC and WB.
Target
Human PRKAB2 / AMPK Beta 2
Synonyms
PRKAB2 | AMPK beta-2 chain | AMPK beta 2 | AMPK subunit beta-2
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG2b Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human AMPK beta 2 (56-89 aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PRKAB2 / AMPK Beta 2
O43741 NM_005399 NP_005390.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/25/2024