Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > PPT1 / CLN1 > LS-C407993
 
Print Page  
Catalog Number Size Price
LS-C407993-10 10 µg $318 
LS-C407993-100 100 µg $470 
PPT1 / CLN1 Antibody - PPT1 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
PPT1 / CLN1 Antibody - Western blot analysis of PPT1 using anti-PPT1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates, Lane 3: rat liver tissue lysates, Lane 4: mouse liver tissue lysates, Lane 5: HEPG2 whole Cell lysates, Lane 6: 293T whole cell lysates, Lane 7: MCF-7 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PPT1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PPT1.
PPT1 / CLN1 Antibody - PPT1 antibody Western blot. All lanes: Anti PPT1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: 22RV1 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A431 Whole Cell Lysate at 40 ug. Lane 6: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 34 kD. Observed band size: 34 kD.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of THP-1 cells using anti-PPT1 antibody. Overlay histogram showing THP-1 cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of SiHa cells using anti-PPT1 antibody. Overlay histogram showing SiHa cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of U937 cells using anti-PPT1 antibody. Overlay histogram showing U937 cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPT1 / CLN1 Antibody - PPT1 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
PPT1 / CLN1 Antibody - Western blot analysis of PPT1 using anti-PPT1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates, Lane 3: rat liver tissue lysates, Lane 4: mouse liver tissue lysates, Lane 5: HEPG2 whole Cell lysates, Lane 6: 293T whole cell lysates, Lane 7: MCF-7 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PPT1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PPT1.
PPT1 / CLN1 Antibody - PPT1 antibody Western blot. All lanes: Anti PPT1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: 22RV1 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A431 Whole Cell Lysate at 40 ug. Lane 6: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 34 kD. Observed band size: 34 kD.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of THP-1 cells using anti-PPT1 antibody. Overlay histogram showing THP-1 cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of SiHa cells using anti-PPT1 antibody. Overlay histogram showing SiHa cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPT1 / CLN1 Antibody - Flow Cytometry analysis of U937 cells using anti-PPT1 antibody. Overlay histogram showing U937 cells stained with anti-PPT1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human PPT1 / CLN1 Antibody (aa191‑224, IHC, WB) LS‑C407993

Polyclonal Rabbit anti‑Human PPT1 / CLN1 Antibody (aa191‑224, IHC, WB) LS‑C407993

Submit Review LSBio Guarantee
Antibody:
PPT1 / CLN1 Rabbit anti-Human Polyclonal (aa191-224) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407993-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
PPT1 / CLN1 Rabbit anti-Human Polyclonal (aa191-224) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CLN1 antibody LS-C407993 is an unconjugated rabbit polyclonal antibody to CLN1 (PPT1) (aa191-224) from human. It is reactive with human and rat. Validated for IHC and WB.
Target
Human PPT1 / CLN1
Synonyms
PPT1 | CLN1 | Palmitoyl-protein hydrolase 1 | Palmitoyl-protein thioesterase | INCL | PPT-1 | PPT
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human PPT1 (191-224 aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.
Epitope
aa191-224
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PPT1 / CLN1
P50897 NM_000310 NP_000301.1

Publications (0)

Submit a Publication for LS-C407993

Customer Reviews (0)

Submit a review for LS-C407993

Featured Products

PPT1 / CLN1 Antibody - Western blot of recombinant PPT1 / PPT.
PPT1 / CLN1 Antibody (aa28‑279) LS‑C314992
Species: Mouse
Applications: Western blot
PPT1 / CLN1 Antibody - Western blot of hPPT1-C46 in mouse cerebellum tissue lysates (35 ug/lane). PPT1 (arrow) was detected using the purified antibody.
PPT1 / CLN1 Antibody (aa32‑63) LS‑C98514
Species: Human, Mouse
Applications: Western blot
PPT1 / CLN1 Antibody - Immunohistochemistry of paraffin-embedded human ovarian cancer at dilution of 1:100
PPT1 / CLN1 Antibody LS‑C679135
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Product
PPT1 / CLN1 Antibody (aa189‑217) LS‑C324254
Species: Human
Applications: Western blot, ELISA
PPT1 / CLN1 Antibody - Western blot of recombinant PPT1 / PPT.
PPT1 / CLN1 Antibody (aa28‑279, PE) LS‑C727753
Species: Mouse
Applications: Western blot
PPT1 / CLN1 Antibody - Immunohistochemical of paraffin-embedded R. cerebellum section using PPT1 Antibody. Antibody was diluted at 1:25 dilution. A peroxidase-conjugated goat anti-rabbit IgG at 1:400 dilution was used as the secondary antibody, followed by DAB staining.
PPT1 / CLN1 Antibody (aa1‑306, clone 1117CT11.2.1.4) LS‑C344137
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
See all PPT1 / CLN1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/24/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com