LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

PPP1R8 / Rnase E Antibody LS-C334888

Rnase E antibody LS-C334888 is an unconjugated rabbit polyclonal antibody to Rnase E (PPP1R8) from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C334888-50
50 µl
$235
LS-C334888-100
100 µl
$315
LS-C334888-200
200 µl
$425
Description
Rnase E antibody LS-C334888 is an unconjugated rabbit polyclonal antibody to Rnase E (PPP1R8) from human, mouse and rat. Validated for IHC and WB.
Target
Human PPP1R8 / Rnase E
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human PPP1R8 (NP_612568.1). MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Specificity
Human PPP1R8 / Rnase E / ARD1
Usage
The predicted MW is 13kDa/22kDa/38kDa, while the observed MW by Western blot was 40kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About PPP1R8 / Rnase E
Q12972 NM_002713 NP_002704.1

Popular PPP1R8 / Rnase E Products

Anti-PPP1R8 antibody IHC of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 2.5 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Rabbit, Xenopus, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Immunohistochemistry of paraffin-embedded human pancreatic cancer at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human pancreatic cancer at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: ICC, Immunofluorescence, Flow Cytometry

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse kidney tissue.
Immunohistochemistry of paraffin-embedded Mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat stomach tissue.
Immunohistochemistry of paraffin-embedded Rat stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat brain tissue.
Immunohistochemistry of paraffin-embedded Rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse liver tissue.
Immunohistochemistry of paraffin-embedded Mouse liver tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Human adenomyosis.
Immunohistochemistry of paraffin-embedded Human adenomyosis.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse kidney tissue.
Immunohistochemistry of paraffin-embedded Mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat stomach tissue.
Immunohistochemistry of paraffin-embedded Rat stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat brain tissue.
Immunohistochemistry of paraffin-embedded Rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse liver tissue.
Immunohistochemistry of paraffin-embedded Mouse liver tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Human adenomyosis.
Immunohistochemistry of paraffin-embedded Human adenomyosis.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse kidney tissue.
Immunohistochemistry of paraffin-embedded Mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat stomach tissue.
Immunohistochemistry of paraffin-embedded Rat stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat brain tissue.
Immunohistochemistry of paraffin-embedded Rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse liver tissue.
Immunohistochemistry of paraffin-embedded Mouse liver tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Human adenomyosis.
Immunohistochemistry of paraffin-embedded Human adenomyosis.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse kidney tissue.
Immunohistochemistry of paraffin-embedded Mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat stomach tissue.
Immunohistochemistry of paraffin-embedded Rat stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Rat brain tissue.
Immunohistochemistry of paraffin-embedded Rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Mouse liver tissue.
Immunohistochemistry of paraffin-embedded Mouse liver tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded Human adenomyosis.
Immunohistochemistry of paraffin-embedded Human adenomyosis.

Requested From: United States
Date Requested: 5/22/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy