Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C749901-20 20 µl $253 
LS-C749901-50 50 µl $279 
LS-C749901-100 100 µl $333 
LS-C749901-200 200 µl $429 

Polyclonal Rabbit anti‑Human OXCT2 Antibody (WB) LS‑C749901

Polyclonal Rabbit anti‑Human OXCT2 Antibody (WB) LS‑C749901

OXCT2 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


OXCT2 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


OXCT2 antibody LS-C749901 is an unconjugated rabbit polyclonal antibody to OXCT2 from human. It is reactive with human and mouse. Validated for WB.
Human OXCT2
OXCT2 | 3-oxoacid CoA-transferase 2A | 3-oxoacid CoA transferase 2 | 3-oxoacid-CoA transferase 2A | FKSG25 | SCOT-t | SCOTT
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1). QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR
  • Western blot (1:500 - 1:2000)
The predicted MW is 56kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About OXCT2
Q9BYC2 NM_022120 NP_071403.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/14/2021